Lineage for d4hcrm_ (4hcr M:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2755749Domain d4hcrm_: 4hcr M: [408978]
    Other proteins in same PDB: d4hcra2, d4hcrb2, d4hcrl2, d4hcrn2
    automated match to d6shgh_

Details for d4hcrm_

PDB Entry: 4hcr (more details), 2.3 Å

PDB Description: crystal structure of human madcam-1 d1d2 complexed with fab pf-547659
PDB Compounds: (M:) PF-547659 heavy chain

SCOPe Domain Sequences for d4hcrm_:

Sequence, based on SEQRES records: (download)

>d4hcrm_ b.1.1.0 (M:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqlvqsgaevkkpgasvkvsckasgytftsyginwvrqapgqglewmgwisvysgntny
aqkvqgrvtmtadtststaymdlrslrsddtavyycaregssssgdyyygmdvwgqgttv
tvssastkgpsvfplapcsrstsestaalgclvkdyfpepvtvswnsgaltsgvhtfpav
lqssglyslssvvtvpssnfgtqtytcnvdhkpsntkvdktve

Sequence, based on observed residues (ATOM records): (download)

>d4hcrm_ b.1.1.0 (M:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqlvqsgaevkkpgasvkvsckasgytftsyginwvrqapgqglewmgwisvysgntny
aqkvqgrvtmtadtststaymdlrslrsddtavyycaregssssgdyyygmdvwgqgttv
tvssastkgpsvfplapcstaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgl
yslssvvtvpssnfgtqtytcnvdhkpsntkvdktve

SCOPe Domain Coordinates for d4hcrm_:

Click to download the PDB-style file with coordinates for d4hcrm_.
(The format of our PDB-style files is described here.)

Timeline for d4hcrm_:

  • d4hcrm_ is new in SCOPe 2.08-stable