SCOP 1.71: Domain d3pyp__: 3pyp -

Lineage for d3pyp__ (3pyp -)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.110: Profilin-like [55769] (7 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (6 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.1: PYP-like [55786] (2 proteins)

6. Protein Photoactive yellow protein, PYP [55787] (1 species)

7. Species Ectothiorhodospira halophila [TaxId:17] [55788] (27 PDB entries)

8. Domain d3pyp__: 3pyp - [40897]
   cryotrapped early light cycle intermediate
   complexed with hc4

Details for d3pyp__

PDB Entry: 3pyp, 0.85 Å

PDB Description: photoactive yellow protein, cryotrapped early light cycle intermediate

SCOP Domain Sequences for d3pyp__:

Sequence; same for both SEQRES and ATOM records:

>d3pyp__ d.110.3.1 (-) Photoactive yellow protein, PYP {Ectothiorhodospira halophila}
mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigk
nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
fvkrv

Timeline for d3pyp__:

• d3pyp__ first appeared (with stable ids) in SCOP 1.55
  
• d3pyp__ appears in SCOP 1.69
  
• d3pyp__ is called d3pypa_ in SCOP 1.73
  
• d3pyp__ appears in the current release, SCOPe 2.08, called d3pypa_