Lineage for d1f5mb_ (1f5m B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1427772Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1427834Superfamily d.110.2: GAF domain-like [55781] (5 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. 1427835Family d.110.2.1: GAF domain [55782] (8 proteins)
  6. 1427868Protein Hypothetical protein ykl069wp [55783] (1 species)
  7. 1427869Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55784] (2 PDB entries)
  8. 1427871Domain d1f5mb_: 1f5m B: [40896]
    structural genomics
    complexed with br

Details for d1f5mb_

PDB Entry: 1f5m (more details), 1.9 Å

PDB Description: structure of the gaf domain
PDB Compounds: (B:) gaf

SCOPe Domain Sequences for d1f5mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f5mb_ d.110.2.1 (B:) Hypothetical protein ykl069wp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sstgfhhadhvnyssnlnkeeileqlllsyeglsdgqvnwvcnlsnassliwhaykslav
dinwagfyvtqaseentlilgpfqgkvacqmiqfgkgvcgtaastketqivpdvnkypgh
iacdgetkseivvpiisndgktlgvididcldyegfdhvdkefleklaklinkscvf

SCOPe Domain Coordinates for d1f5mb_:

Click to download the PDB-style file with coordinates for d1f5mb_.
(The format of our PDB-style files is described here.)

Timeline for d1f5mb_: