Lineage for d1f5ma_ (1f5m A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970135Superfamily d.110.2: GAF domain-like [55781] (5 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. 2970136Family d.110.2.1: GAF domain [55782] (8 proteins)
  6. 2970177Protein Hypothetical protein ykl069wp [55783] (1 species)
  7. 2970178Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55784] (2 PDB entries)
  8. 2970179Domain d1f5ma_: 1f5m A: [40895]
    structural genomics
    complexed with br

Details for d1f5ma_

PDB Entry: 1f5m (more details), 1.9 Å

PDB Description: structure of the gaf domain
PDB Compounds: (A:) gaf

SCOPe Domain Sequences for d1f5ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f5ma_ d.110.2.1 (A:) Hypothetical protein ykl069wp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
stgfhhadhvnyssnlnkeeileqlllsyeglsdgqvnwvcnlsnassliwhaykslavd
inwagfyvtqaseentlilgpfqgkvacqmiqfgkgvcgtaastketqivpdvnkypghi
acdgetkseivvpiisndgktlgvididcldyegfdhvdkefleklaklinkscvf

SCOPe Domain Coordinates for d1f5ma_:

Click to download the PDB-style file with coordinates for d1f5ma_.
(The format of our PDB-style files is described here.)

Timeline for d1f5ma_: