Lineage for d1f5ma_ (1f5m A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.110: Profilin-like [55769] (10 superfamilies)
core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
Superfamily d.110.2: GAF domain-like [55781] (5 families) 
alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
Family d.110.2.1: GAF domain [55782] (8 proteins) 
Protein Hypothetical protein ykl069wp [55783] (1 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55784] (2 PDB entries) 
Domain d1f5ma_: 1f5m A: [40895]
structural genomics
complexed with br
Details for d1f5ma_
PDB Entry: 1f5m (more details), 1.9 Å
PDB Description: structure of the gaf domain
PDB Compounds: (A:) gafSCOPe Domain Sequences for d1f5ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f5ma_ d.110.2.1 (A:) Hypothetical protein ykl069wp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
stgfhhadhvnyssnlnkeeileqlllsyeglsdgqvnwvcnlsnassliwhaykslavd
inwagfyvtqaseentlilgpfqgkvacqmiqfgkgvcgtaastketqivpdvnkypghi
acdgetkseivvpiisndgktlgvididcldyegfdhvdkefleklaklinkscvf
SCOPe Domain Coordinates for d1f5ma_:
Click to download the PDB-style file with coordinates for d1f5ma_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f5ma_:
- d1f5ma_ first appeared (with stable ids) in SCOP 1.55
- d1f5ma_ appears in SCOPe 2.07
View in 3D
