SCOPe 2.06: Domain d1g5ub_: 1g5u B:

Lineage for d1g5ub_ (1g5u B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.1: Profilin (actin-binding protein) [55770] (2 families)
   alpha-beta(2)-alpha-beta(5)-alpha

5. Family d.110.1.1: Profilin (actin-binding protein) [55771] (2 proteins)
   automatically mapped to Pfam PF00235

6. Protein Profilin (actin-binding protein) [55772] (8 species)

7. Species Rubber tree (Hevea brasiliensis), hevb8 [TaxId:3981] [55780] (1 PDB entry)

8. Domain d1g5ub_: 1g5u B: [40894]
   complexed with na

Details for d1g5ub_

PDB Entry: 1g5u, 3.1 Å

PDB Description: latex profilin hevb8

PDB Compounds: (B:) Profilin

SCOPe Domain Sequences for d1g5ub_:

Sequence; same for both SEQRES and ATOM records:

>d1g5ub_ d.110.1.1 (B:) Profilin (actin-binding protein) {Rubber tree (Hevea brasiliensis), hevb8 [TaxId: 3981]}
swqtyvddhlmcdidghrltaaaiighdgsvwaqsssfpqfksdevaavmkdfdepgsla
ptglhlggtkymviqgepgavirgkkgsggitvkrtgqaliigiydepltpgqcnmiver
lgdylldqgl

Timeline for d1g5ub_:

• d1g5ub_ first appeared (with stable ids) in SCOP 1.55
  
• d1g5ub_ appears in SCOPe 2.05
  
• d1g5ub_ appears in SCOPe 2.07
  
• d1g5ub_ appears in the current release, SCOPe 2.08