Lineage for d4fqja_ (4fqj A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2776220Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2776221Protein automated matches [227017] (58 species)
    not a true protein
  7. 2776769Species Influenza b virus [TaxId:1171632] [419901] (1 PDB entry)
  8. 2776770Domain d4fqja_: 4fqj A: [408934]
    Other proteins in same PDB: d4fqjh_, d4fqjl1, d4fqjl2
    automated match to d6e56a_

Details for d4fqja_

PDB Entry: 4fqj (more details), 2.5 Å

PDB Description: influenza b/florida/4/2006 hemagglutinin fab cr8071 complex
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d4fqja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fqja_ b.19.1.0 (A:) automated matches {Influenza b virus [TaxId: 1171632]}
tttptksyfanlkgtrtrgklcpdclnctdldvalgrpmcvgttpsakasilhevkpvts
gcfpimhdrtkirqlpnllrgyenirlstqnvidaekapggpyrlgtsgscpnatsksgf
fatmawavpkdnnknatnpltvevpyictegedqitvwgfhsddktqmknlygdsnpqkf
tssangvtthyvsqigsfpdqtedgglpqsgrivvdymmqkpgktgtivyqrgvllpqkv
wcasgrskvikgslpligeadclhekygglnkskpyytgehakaigncpiwvkt

SCOPe Domain Coordinates for d4fqja_:

Click to download the PDB-style file with coordinates for d4fqja_.
(The format of our PDB-style files is described here.)

Timeline for d4fqja_:

  • d4fqja_ is new in SCOPe 2.08-stable