Lineage for d4f2mc1 (4f2m C:9-220)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) Protein automated matches [190119] (24 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries) 
Domain d4f2mc1: 4f2m C:9-220 [408899]
Other proteins in same PDB: d4f2ma2, d4f2mb1, d4f2mb2, d4f2mc2, d4f2md1, d4f2md2
automated match to d6shgh_
complexed with acy, nag
Details for d4f2mc1
PDB Entry: 4f2m (more details), 3 Å
PDB Description: crystal structure of a tgev coronavirus spike fragment in complex with the tgev neutralizing monoclonal antibody 1af10
PDB Compounds: (C:) monoclonal antibody 1AF10, heavy chainSCOPe Domain Sequences for d4f2mc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f2mc1 b.1.1.1 (C:9-220) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
pelvkpgasvkisckasgyafssswmnwvkqrpgqglewigriypgdgetnysekfkgka
tltadkssstaymhlssltsvdsavyfcarggyrydpyyamdywgqgtsvtvssakttap
svyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlss
svtvtsstwpsqsitcnvahpasstkvdkkie
SCOPe Domain Coordinates for d4f2mc1:
Click to download the PDB-style file with coordinates for d4f2mc1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4f2mc1:
- d4f2mc1 is new in SCOPe 2.08-stable
View in 3D
