Lineage for d4f15h_ (4f15 H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2745344Domain d4f15h_: 4f15 H: [408895]
    Other proteins in same PDB: d4f15c1, d4f15c2, d4f15f1, d4f15f2, d4f15i1, d4f15i2, d4f15l1, d4f15l2
    automated match to d6shgh_

Details for d4f15h_

PDB Entry: 4f15 (more details), 2.81 Å

PDB Description: molecular basis of infectivity of 2009 pandemic h1n1 influenza a viruses
PDB Compounds: (H:) Fab fragment, heavy chain

SCOPe Domain Sequences for d4f15h_:

Sequence, based on SEQRES records: (download)

>d4f15h_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vklqesgavvqpggslrlscaasgftgsdydmswirqapgkglewvsgilggsersyyrd
svkgrstisrdnsrktlylemnslraedtavyycarhswgayvqygmdgwgqgttvtvss
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltssvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkksc

Sequence, based on observed residues (ATOM records): (download)

>d4f15h_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vklqesgavvqpggslrlscaasgftgsdydmswirqapgkglewvsgilggsersyyrd
svkgrstisrdnsrktlylemnslraedtavyycarhswggwgqgttvtvssastkgpsv
fplapstsggtaalgclvkdyfpepvtvswnsgaltssvhtfpavlqssglyslssvvtv
pssslgtqtyicnvnhkpsntkvdkksc

SCOPe Domain Coordinates for d4f15h_:

Click to download the PDB-style file with coordinates for d4f15h_.
(The format of our PDB-style files is described here.)

Timeline for d4f15h_:

  • d4f15h_ is new in SCOPe 2.08-stable