Lineage for d1ypra_ (1ypr A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35199Fold d.110: Profilin-like [55769] (3 superfamilies)
  4. 35200Superfamily d.110.1: Profilin (actin-binding protein) [55770] (1 family) (S)
  5. 35201Family d.110.1.1: Profilin (actin-binding protein) [55771] (1 protein)
  6. 35202Protein Profilin (actin-binding protein) [55772] (8 species)
  7. 35210Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55777] (1 PDB entry)
  8. 35211Domain d1ypra_: 1ypr A: [40888]

Details for d1ypra_

PDB Entry: 1ypr (more details), 2.3 Å

PDB Description: saccharomyces cerevisiae (yeast) profilin

SCOP Domain Sequences for d1ypra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ypra_ d.110.1.1 (A:) Profilin (actin-binding protein) {Baker's yeast (Saccharomyces cerevisiae)}
swqaytdnligtgkvdkaviysragdavwatsgglslqpneigeivqgfdnpaglqsngl
hiqgqkfmllraddrsiygrhdaegvvcvrtkqtviiahypptvqageatkiveqladyl
igvqy

SCOP Domain Coordinates for d1ypra_:

Click to download the PDB-style file with coordinates for d1ypra_.
(The format of our PDB-style files is described here.)

Timeline for d1ypra_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1yprb_