Lineage for d4ebqh1 (4ebq H:10-222)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2759506Domain d4ebqh1: 4ebq H:10-222 [408876]
    Other proteins in same PDB: d4ebqh2, d4ebql2
    automated match to d6shgh_
    complexed with cl, edo, gol, po4

Details for d4ebqh1

PDB Entry: 4ebq (more details), 1.6 Å

PDB Description: Fab structure of anti-Vaccinia virus D8L antigen mouse IgG2a LA5
PDB Compounds: (H:) anti-Vaccinia D8L antigen monoclonal IgG2a antibody LA5, heavy chain

SCOPe Domain Sequences for d4ebqh1:

Sequence, based on SEQRES records: (download)

>d4ebqh1 b.1.1.0 (H:10-222) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
pelvkpgasvkisckasgysfnfywmhwvkqrpgqglewigmidpsesesrlnqkfkdka
tltvdrssstahmqlssptsedsavyyctrsnyrydyfdvwgagttvtvssakttapsvy
plapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlsssvt
vtsstwpsesitcnvahpasstkvdkkieprgp

Sequence, based on observed residues (ATOM records): (download)

>d4ebqh1 b.1.1.0 (H:10-222) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
pelvkpgasvkisckasgysfnfywmhwvkqrpgqglewigmidpsesesrlnqkfkdka
tltvdrssstahmqlssptsedsavyyctrsnyrydyfdvwgagttvtvssakttapsvy
plapvcggssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlsssvtvts
stwpsesitcnvahpasstkvdkkieprgp

SCOPe Domain Coordinates for d4ebqh1:

Click to download the PDB-style file with coordinates for d4ebqh1.
(The format of our PDB-style files is described here.)

Timeline for d4ebqh1:

  • d4ebqh1 is new in SCOPe 2.08-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d4ebqh2