Lineage for d4dvbh_ (4dvb H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744331Domain d4dvbh_: 4dvb H: [408874]
    Other proteins in same PDB: d4dvbb1, d4dvbb2, d4dvbl1, d4dvbl2
    automated match to d6shgh_
    complexed with pg4, so4

Details for d4dvbh_

PDB Entry: 4dvb (more details), 1.93 Å

PDB Description: The crystal structure of the Fab fragment of pro-uPA antibody mAb-112
PDB Compounds: (H:) Fab fragment of pro-uPA antibody mAb-112

SCOPe Domain Sequences for d4dvbh_:

Sequence, based on SEQRES records: (download)

>d4dvbh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qvklqesggdlvkpggslklscsasgftfsryamswvrqtpekrlewvasitnggstyys
dsvkgrfiisrdnarnilslqmsslrsedtamyycergeltyamdywgqgttvtvssakt
tppsvyplapgnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssv
tvpsstwpsetvtcnvahpasstkvdkkivvkg

Sequence, based on observed residues (ATOM records): (download)

>d4dvbh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qvklqesggdlvkpggslklscsasgftfsryamswvrqtpekrlewvasitnggstyys
dsvkgrfiisrdnarnilslqmsslrsedtamyycergeltyamdywgqgttvtvssakt
tppsvyplapgsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvt
vpsstwpsetvtcnvahpasstkvdkkivvkg

SCOPe Domain Coordinates for d4dvbh_:

Click to download the PDB-style file with coordinates for d4dvbh_.
(The format of our PDB-style files is described here.)

Timeline for d4dvbh_:

  • d4dvbh_ is new in SCOPe 2.08-stable