Lineage for d2prfa_ (2prf A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1037952Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1037953Superfamily d.110.1: Profilin (actin-binding protein) [55770] (2 families) (S)
    alpha-beta(2)-alpha-beta(5)-alpha
  5. 1037954Family d.110.1.1: Profilin (actin-binding protein) [55771] (2 proteins)
  6. 1037955Protein Profilin (actin-binding protein) [55772] (8 species)
  7. 1037956Species Acanthamoeba castellanii [TaxId:5755] [55776] (5 PDB entries)
  8. 1037962Domain d2prfa_: 2prf A: [40887]

Details for d2prfa_

PDB Entry: 2prf (more details)

PDB Description: three dimensional solution structure of acanthamoeba profilin i
PDB Compounds: (A:) profilin ia

SCOPe Domain Sequences for d2prfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2prfa_ d.110.1.1 (A:) Profilin (actin-binding protein) {Acanthamoeba castellanii [TaxId: 5755]}
swqtyvdtnlvgtgavtqaailgldgntwatsagfavtpaqgqtlasafnnadpirasgf
dlagvhyvtlraddrsiygkkgsagvitvktsksilvgvynekiqpgtaanvvekladyl
igqgf

SCOPe Domain Coordinates for d2prfa_:

Click to download the PDB-style file with coordinates for d2prfa_.
(The format of our PDB-style files is described here.)

Timeline for d2prfa_: