Lineage for d4at6m1 (4at6 M:13-218)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2745114Domain d4at6m1: 4at6 M:13-218 [408828]
    Other proteins in same PDB: d4at6b2, d4at6d2, d4at6f2, d4at6i2, d4at6k2, d4at6l2, d4at6m2, d4at6n2, d4at6o2, d4at6p2
    automated match to d6shgh_

Details for d4at6m1

PDB Entry: 4at6 (more details), 2.55 Å

PDB Description: fab fragment of antiporphyrin antibody 14h7
PDB Compounds: (M:) fab 14h7 heavy chain

SCOPe Domain Sequences for d4at6m1:

Sequence, based on SEQRES records: (download)

>d4at6m1 b.1.1.1 (M:13-218) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tpgasvkmsctasgysfssynihwvkqtpgqglewigviypgngdtsynqkfrdkatlta
dkssstaymqlssltsedsavyhcarggsgllaywgqgtlvtvssakttppsvyplapgs
aaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvtvpsstw
psetvtcnvahpasstkvdkkivpr

Sequence, based on observed residues (ATOM records): (download)

>d4at6m1 b.1.1.1 (M:13-218) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tpgasvkmscssynihwvkqtpgqglewigviypgngdtsynqkfrdkatltadksssta
ymqlssltsedsavyhcarggsgllaywgqgtlvtvssakttppsvyplapgsaaqtnsm
vtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvtvpsstwpsetvtc
nvahpasstkvdkkivpr

SCOPe Domain Coordinates for d4at6m1:

Click to download the PDB-style file with coordinates for d4at6m1.
(The format of our PDB-style files is described here.)

Timeline for d4at6m1:

  • d4at6m1 is new in SCOPe 2.08-stable