Lineage for d1acf__ (1acf -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.110: Profilin-like [55769] (3 superfamilies) 
Superfamily d.110.1: Profilin (actin-binding protein) [55770] (1 family) 
Family d.110.1.1: Profilin (actin-binding protein) [55771] (1 protein) Protein Profilin (actin-binding protein) [55772] (8 species) 
Species Acanthamoeba castellanii [TaxId:5755] [55776] (5 PDB entries) 
Domain d1acf__: 1acf - [40882]
Details for d1acf__
PDB Entry: 1acf (more details), 2 Å
PDB Description: acanthamoeba castellanii profilin ib
SCOP Domain Sequences for d1acf__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1acf__ d.110.1.1 (-) Profilin (actin-binding protein) {Acanthamoeba castellanii}
swqtyvdtnlvgtgavtqaailgldgntwatsagfavtpaqgttlagafnnadairaggf
dlagvhyvtlraddrsiygkkgssgvitvktskailvgvynekiqpgtaanvvekladyl
igqgf
SCOP Domain Coordinates for d1acf__:
Click to download the PDB-style file with coordinates for d1acf__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1acf__:
- d1acf__ appears in SCOP 1.57
- d1acf__ appears in the current release, SCOPe 2.08, called d1acfa_
View in 3D