Lineage for d4aeij_ (4aei J:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744436Domain d4aeij_: 4aei J: [408801]
    Other proteins in same PDB: d4aeia_, d4aeib_, d4aeic_, d4aeil2, d4aeim2, d4aein2
    automated match to d6shgh_
    complexed with cl, epe

Details for d4aeij_

PDB Entry: 4aei (more details), 2.3 Å

PDB Description: Crystal structure of the AaHII-Fab4C1 complex
PDB Compounds: (J:) fab antibody heavy chain

SCOPe Domain Sequences for d4aeij_:

Sequence, based on SEQRES records: (download)

>d4aeij_ b.1.1.1 (J:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evhlvesggglvkpggslklscaasgftfsgyymywvrqtpekrlewvasisdggsftyy
pdsvkgrftisrdnaknnlylqmsslrsddtamyycsrpddysydgfaywgqgtlvtvsa
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkiv

Sequence, based on observed residues (ATOM records): (download)

>d4aeij_ b.1.1.1 (J:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evhlvesggglvkpggslklscaasgftfsgyymywvrqtpekrlewvasisdggsftyy
pdsvkgrftisrdnaknnlylqmsslrsddtamyycsrpddysydgfaywgqgtlvtvsa
akttppsvyplavtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvtv
psstwpsetvtcnvahpasstkvdkkiv

SCOPe Domain Coordinates for d4aeij_:

Click to download the PDB-style file with coordinates for d4aeij_.
(The format of our PDB-style files is described here.)

Timeline for d4aeij_:

  • d4aeij_ is new in SCOPe 2.08-stable