Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.1: Profilin (actin-binding protein) [55770] (2 families) alpha-beta(2)-alpha-beta(5)-alpha |
Family d.110.1.1: Profilin (actin-binding protein) [55771] (2 proteins) automatically mapped to Pfam PF00235 |
Protein Profilin (actin-binding protein) [55772] (8 species) |
Species Human (Homo sapiens), isoform I [TaxId:9606] [55774] (6 PDB entries) |
Domain d1cjfb_: 1cjf B: [40876] complexed with hom |
PDB Entry: 1cjf (more details), 2.3 Å
SCOPe Domain Sequences for d1cjfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cjfb_ d.110.1.1 (B:) Profilin (actin-binding protein) {Human (Homo sapiens), isoform I [TaxId: 9606]} gwnayidnlmadgtcqdaaivgykdspsvwaavpgktfvnitpaevgvlvgkdrssfyvn gltlggqkcsvirdsllqdgefsmdlrtkstggaptfnvtvtktdktlvllmgkegvhgg linkkcyemashlrrsqy
Timeline for d1cjfb_: