Lineage for d3vi3h_ (3vi3 H:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. Protein automated matches [190119] (23 species)
    not a true protein
  7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (610 PDB entries)
  8. Domain d3vi3h_: 3vi3 H: [408754]
    Other proteins in same PDB: d3vi3a1, d3vi3a2, d3vi3c1, d3vi3c2, d3vi3e1, d3vi3e2, d3vi3l1, d3vi3l2
    automated match to d6shgh_
    complexed with ca, mg, nag

Details for d3vi3h_

PDB Entry: 3vi3 (more details), 2.9 Å

PDB Description: crystal structure of alpha5beta1 integrin headpiece (ligand-free form)
PDB Compounds: (H:) SG/19 Fab fragment (Heavy chain)

SCOPe Domain Sequences for d3vi3h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vi3h_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qvhlqqsgaelmkpgasvkisckatgytftsywiewvkqrpghglewlgeilpgsgyihy
nekfkgkatfttdtssntaymqlssltsedsavyycsralalyamdywgqgtsvtvssak
ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
tlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr

SCOPe Domain Coordinates for d3vi3h_ are not available.

Timeline for d3vi3h_:

  • d3vi3h_ is new in SCOPe 2.08-stable

View in 3D
Domains from other chains:
(mouse over for more information)
d3vi3a1, d3vi3a2, d3vi3c1, d3vi3c2, d3vi3e1, d3vi3e2, d3vi3f_, d3vi3l1, d3vi3l2