| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
| Domain d3vg0h_: 3vg0 H: [408749] Other proteins in same PDB: d3vg0l2 automated match to d6shgh_ complexed with act, so4 |
PDB Entry: 3vg0 (more details), 2.27 Å
SCOPe Domain Sequences for d3vg0h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vg0h_ b.1.1.0 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evkllesgpglvapseslsitctisgfsltddgvswirqppgkglewlgviwgggstyfn
slfksrlsitrdnsksqvflemdslqtddtamyycakhdghetmdywgqgtsvtvssskt
tppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlyt
lsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
Timeline for d3vg0h_: