Lineage for d3v6fa_ (3v6f A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744489Domain d3v6fa_: 3v6f A: [408742]
    Other proteins in same PDB: d3v6fb1, d3v6fb2, d3v6fd1, d3v6fd2, d3v6ff1, d3v6ff2, d3v6fl1, d3v6fl2
    automated match to d6shgh_

Details for d3v6fa_

PDB Entry: 3v6f (more details), 2.52 Å

PDB Description: Crystal Structure of an anti-HBV e-antigen monoclonal Fab fragment (e6), unbound
PDB Compounds: (A:) Fab e6 Heavy Chain

SCOPe Domain Sequences for d3v6fa_:

Sequence, based on SEQRES records: (download)

>d3v6fa_ b.1.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlvesggdlvkpggslklscaasgftfssygmswvrqtpdkrlewvatissggnyiyy
pdtvkgrftisrdnakntlylqmsslksedtamyyctregaysgsssypmdywgqgtsvt
vssakttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpall
qsglytmsssvtvpsstwpsqtvtcsvahpassttvdkklepsg

Sequence, based on observed residues (ATOM records): (download)

>d3v6fa_ b.1.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlvesggdlvkpggslklscaasgftfssygmswvrqtpdkrlewvatissggnyiyy
pdtvkgrftisrdnakntlylqmsslksedtamyyctregaysgsssypmdywgqgtsvt
vssakttppsvyplapgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsglyt
msssvtvpsstwpsqtvtcsvahpassttvdkklepsg

SCOPe Domain Coordinates for d3v6fa_:

Click to download the PDB-style file with coordinates for d3v6fa_.
(The format of our PDB-style files is described here.)

Timeline for d3v6fa_:

  • d3v6fa_ is new in SCOPe 2.08-stable