Lineage for d3utzb_ (3utz B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744759Domain d3utzb_: 3utz B: [408724]
    Other proteins in same PDB: d3utza2, d3utzd2, d3utze2
    automated match to d6shgh_
    complexed with so4

Details for d3utzb_

PDB Entry: 3utz (more details), 2.18 Å

PDB Description: endogenous-like inhibitory antibodies targeting activated metalloproteinase motifs show therapeutic potential
PDB Compounds: (B:) Metalloproteinase, heavy chain

SCOPe Domain Sequences for d3utzb_:

Sequence, based on SEQRES records: (download)

>d3utzb_ b.1.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evklvesggglvkpggslklscaasgfafstydmswirqtpekrlewvatissggsytyy
pdsvkgrftiskdnarntlylqmsslrsgdtalyyctrfrydgwyfdvwgqgttvtvssa
stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
lyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvep

Sequence, based on observed residues (ATOM records): (download)

>d3utzb_ b.1.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evklvesggglvkpggslklscaasgfafstydmswirqtpekrlewvatissggsytyy
pdsvkgrftiskdnarntlylqmsslrsgdtalyyctrfrydgwyfdvwgqgttvtvssa
stkgpsvfplapsskstgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
slssvvtvpssslgtqtyicnvnhkpsntkvdkrvep

SCOPe Domain Coordinates for d3utzb_:

Click to download the PDB-style file with coordinates for d3utzb_.
(The format of our PDB-style files is described here.)

Timeline for d3utzb_:

  • d3utzb_ is new in SCOPe 2.08-stable