Lineage for d3u46h_ (3u46 H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2743341Domain d3u46h_: 3u46 H: [408707]
    Other proteins in same PDB: d3u46b1, d3u46b2, d3u46l1, d3u46l2
    automated match to d6shgh_

Details for d3u46h_

PDB Entry: 3u46 (more details), 2.91 Å

PDB Description: CH04H/CH02L P212121
PDB Compounds: (H:) CH04 Heavy Chain Fab

SCOPe Domain Sequences for d3u46h_:

Sequence, based on SEQRES records: (download)

>d3u46h_ b.1.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglirpggslrlsckgsgfifenfgfgwvrqgpgkglewvsgtnwnggdsry
gdsvkgrftisrdnsnnfvylqmnslrpedtaiyycargtdytiddqgiryqgsgtfwyf
dvwgrgtlvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgalt
sgvhtfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Sequence, based on observed residues (ATOM records): (download)

>d3u46h_ b.1.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglirpggslrlsckgsgfifenfgfgwvrqgpgkglewvsgtnwnggdsry
gdsvkgrftisrdnsnnfvylqmnslrpedtaiyycargtdytiddqgiryqgsgtfwyf
dvwgrgtlvtvssastkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvht
fpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

SCOPe Domain Coordinates for d3u46h_:

Click to download the PDB-style file with coordinates for d3u46h_.
(The format of our PDB-style files is described here.)

Timeline for d3u46h_:

  • d3u46h_ is new in SCOPe 2.08-stable