Lineage for d3u2sh_ (3u2s H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2754637Domain d3u2sh_: 3u2s H: [408703]
    Other proteins in same PDB: d3u2sb2, d3u2sl2
    automated match to d6shgh_
    complexed with bu3, nag, so4

Details for d3u2sh_

PDB Entry: 3u2s (more details), 1.8 Å

PDB Description: crystal structure of pg9 fab in complex with v1v2 region from hiv-1 strain zm109
PDB Compounds: (H:) PG9 heavy chain

SCOPe Domain Sequences for d3u2sh_:

Sequence, based on SEQRES records: (download)

>d3u2sh_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
erlvesgggvvqpgsslrlscaasgfdfsrqgmhwvrqapgqglewvafikydgsekyha
dsvwgrlsisrdnskdtlylqmnslrvedtatyfcvreaggpdyrngynyydfydgyyny
hymdvwgkgttvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsg
altsgvhtfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Sequence, based on observed residues (ATOM records): (download)

>d3u2sh_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
erlvesgggvvqpgsslrlscaasgfdfsrqgmhwvrqapgqglewvafikydgsekyha
dsvwgrlsisrdnskdtlylqmnslrvedtatyfcvreaggpdyrngynyydfydgyyny
hymdvwgkgttvtvssastkgpsvfplapsgtaalgclvkdyfpepvtvswnsgaltsgv
htfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

SCOPe Domain Coordinates for d3u2sh_:

Click to download the PDB-style file with coordinates for d3u2sh_.
(The format of our PDB-style files is described here.)

Timeline for d3u2sh_:

  • d3u2sh_ is new in SCOPe 2.08-stable