Lineage for d3s96a_ (3s96 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744259Domain d3s96a_: 3s96 A: [408660]
    Other proteins in same PDB: d3s96b1, d3s96b2, d3s96d1, d3s96d2
    automated match to d6shgh_

Details for d3s96a_

PDB Entry: 3s96 (more details), 1.9 Å

PDB Description: Crystal structure of 3B5H10
PDB Compounds: (A:) 3B5H10 FAB heavy chain

SCOPe Domain Sequences for d3s96a_:

Sequence, based on SEQRES records: (download)

>d3s96a_ b.1.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qiqlvqsgpelkkpgetvkisckasgytfttygmswvkqapgkgfewmgwintysgvpty
vddfkgrfafsletsastaylqinnlknedtavyfcarggdnylwfaywgqgtlvtvsaa
kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
ytlsssvtvpsstwpsqtvtcnvahpasstkvdkkivprd

Sequence, based on observed residues (ATOM records): (download)

>d3s96a_ b.1.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qiqlvqsgpelkkpgetvkisckasgytfttygmswvkqapgkgfewmgwintysgvpty
vddfkgrfafsletsastaylqinnlknedtavyfcarggdnylwfaywgqgtlvtvsaa
kttppsvyplapgsqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlyt
lsssvtvpsstwpsqtvtcnvahpasstkvdkkivprd

SCOPe Domain Coordinates for d3s96a_:

Click to download the PDB-style file with coordinates for d3s96a_.
(The format of our PDB-style files is described here.)

Timeline for d3s96a_:

  • d3s96a_ is new in SCOPe 2.08-stable