Lineage for d3rpih_ (3rpi H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2757683Domain d3rpih_: 3rpi H: [408652]
    Other proteins in same PDB: d3rpib2, d3rpil2
    automated match to d6shgh_
    complexed with nag

Details for d3rpih_

PDB Entry: 3rpi (more details), 2.65 Å

PDB Description: crystal structure of fab from 3bnc60, highly potent anti-hiv antibody
PDB Compounds: (H:) Heavy chain from highly potent anti-HIV neutralizing antibody

SCOPe Domain Sequences for d3rpih_:

Sequence, based on SEQRES records: (download)

>d3rpih_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vhlsqsgaavtkpgasvrvsceasgykisdhfihwwrqapgqglqwvgwinpktgqpnnp
rqfqgrvsltrqaswdfdtysfymdlkavrsddtaiyfcarqrsdfwdfdvwgsgtqvtv
ssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlq
ssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkrv

Sequence, based on observed residues (ATOM records): (download)

>d3rpih_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vhlsqsgaavtkpgasvrvsceasgykisdhfihwwrqapgqglqwvgwinpktgqpnnp
rqfqgrvsltrqaswdfdtysfymdlkavrsddtaiyfcarqrsdfwdfdvwgsgtqvtv
ssastkgpsvfplaptaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
svvtvpssslgtqtyicnvnhkpsntkvdkrv

SCOPe Domain Coordinates for d3rpih_:

Click to download the PDB-style file with coordinates for d3rpih_.
(The format of our PDB-style files is described here.)

Timeline for d3rpih_:

  • d3rpih_ is new in SCOPe 2.08-stable