Lineage for d1ak6__ (1ak6 -)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 83135Fold d.109: Actin depolymerizing proteins [55752] (1 superfamily)
  4. 83136Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) (S)
  5. 83174Family d.109.1.2: Cofilin-like [55762] (2 proteins)
  6. 83186Protein Destrin [55767] (1 species)
  7. 83187Species Human and pig (Homo sapiens) and (Sus scrofa) [TaxId:9606] [55768] (2 PDB entries)
  8. 83189Domain d1ak6__: 1ak6 - [40865]

Details for d1ak6__

PDB Entry: 1ak6 (more details)

PDB Description: destrin, nmr, minimized average structure

SCOP Domain Sequences for d1ak6__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ak6__ d.109.1.2 (-) Destrin {Human and pig (Homo sapiens) and (Sus scrofa)}
tmitpssgnsasgvqvadevcrifydmkvrkcstpeeikkrkkavifclsadkkciivee
gkeilvgdvgvtitdpfkhfvgmlpekdcryalydasfetkesrkeelmfflwapelapl
kskmiyasskdaikkkfqgikhecqangpedlnraciaeklggslivafegcpv

SCOP Domain Coordinates for d1ak6__:

Click to download the PDB-style file with coordinates for d1ak6__.
(The format of our PDB-style files is described here.)

Timeline for d1ak6__: