Lineage for d3qwoa_ (3qwo A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2759552Domain d3qwoa_: 3qwo A: [408635]
    Other proteins in same PDB: d3qwob2, d3qwoc_, d3qwol2, d3qwop_
    automated match to d6shgh_
    complexed with edo, so4

Details for d3qwoa_

PDB Entry: 3qwo (more details), 1.9 Å

PDB Description: Crystal structure of a motavizumab epitope-scaffold bound to motavizumab Fab
PDB Compounds: (A:) motavizumab heavy chain

SCOPe Domain Sequences for d3qwoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qwoa_ b.1.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qvtlresgpalvkptqtltltctfsgfslstagmsvgwirqppgkalewladiwwddkkh
ynpslkdrltiskdtsknqvvlkvtnmdpadtatyycardmifnfyfdvwgqgttvtvss
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

SCOPe Domain Coordinates for d3qwoa_:

Click to download the PDB-style file with coordinates for d3qwoa_.
(The format of our PDB-style files is described here.)

Timeline for d3qwoa_:

  • d3qwoa_ is new in SCOPe 2.08-stable