Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries) |
Domain d3qpxh1: 3qpx H:1-222 [408630] Other proteins in same PDB: d3qpxh2, d3qpxl1, d3qpxl2 automated match to d6shgh_ complexed with cd, cl, gol, so4 |
PDB Entry: 3qpx (more details), 2 Å
SCOPe Domain Sequences for d3qpxh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qpxh1 b.1.1.1 (H:1-222) automated matches {Human (Homo sapiens) [TaxId: 9606]} evqlvesggglvqpgsplklscaasgltfsanwlnwirqapgkglewvasispdggstsy sdtvkgrfvvskdnakktgylqmnnlrsedtamyycarratrvspfdywgqgvtvtvssa stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
Timeline for d3qpxh1: