SCOPe 2.08: Domain d3qpxh1: 3qpx H:1-222

Lineage for d3qpxh1 (3qpx H:1-222)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)

8. Domain d3qpxh1: 3qpx H:1-222 [408630]
   Other proteins in same PDB: d3qpxh2, d3qpxl1, d3qpxl2
   automated match to d6shgh_
   complexed with cd, cl, gol, so4

Details for d3qpxh1

PDB Entry: 3qpx, 2 Å

PDB Description: Crystal structure of Fab C2507

PDB Compounds: (H:) Fab C2507 heavy chain

SCOPe Domain Sequences for d3qpxh1:

Sequence; same for both SEQRES and ATOM records:

>d3qpxh1 b.1.1.1 (H:1-222) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpgsplklscaasgltfsanwlnwirqapgkglewvasispdggstsy
sdtvkgrfvvskdnakktgylqmnnlrsedtamyycarratrvspfdywgqgvtvtvssa
stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

Timeline for d3qpxh1:

• d3qpxh1 is new in SCOPe 2.08-stable