SCOP 1.75: Domain d1ahqa_: 1ahq A:

Lineage for d1ahqa_ (1ahq A:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.109: Gelsolin-like [55752] (3 superfamilies)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families)

5. Family d.109.1.2: Cofilin-like [55762] (7 proteins)

6. Protein Cofilin (actin depolymerizing factor, ADF) [55763] (4 species)

7. Species Acanthamoeba castellanii, actophorin [TaxId:5755] [55766] (2 PDB entries)

8. Domain d1ahqa_: 1ahq A: [40863]

Details for d1ahqa_

PDB Entry: 1ahq, 2.3 Å

PDB Description: recombinant actophorin

PDB Compounds: (A:) actophorin

SCOP Domain Sequences for d1ahqa_:

Sequence; same for both SEQRES and ATOM records:

>d1ahqa_ d.109.1.2 (A:) Cofilin (actin depolymerizing factor, ADF) {Acanthamoeba castellanii, actophorin [TaxId: 5755]}
giavsddcvqkfnelklghqhryvtfkmnasntevvvehvggpnatyedfksqlperdcr
yaifdyefqvdggqrnkitfilwapdsapikskmmytstkdsikkklvgiqvevqatdaa
eisedavserakk

Timeline for d1ahqa_:

• d1ahqa_ first appeared (with stable ids) in SCOP 1.55, called d1ahq__
  
• d1ahqa_ appears in SCOP 1.73
  
• d1ahqa_ appears in SCOPe 2.01
  
• d1ahqa_ appears in the current release, SCOPe 2.08