Lineage for d1ahq__ (1ahq -)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 83135Fold d.109: Actin depolymerizing proteins [55752] (1 superfamily)
  4. 83136Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) (S)
  5. 83174Family d.109.1.2: Cofilin-like [55762] (2 proteins)
  6. 83175Protein Cofilin (actin depolymerizing factor, ADF) [55763] (3 species)
  7. 83176Species Amoeba (Acanthamoeba castellanii), actophorin [55766] (2 PDB entries)
  8. 83178Domain d1ahq__: 1ahq - [40863]

Details for d1ahq__

PDB Entry: 1ahq (more details), 2.3 Å

PDB Description: recombinant actophorin

SCOP Domain Sequences for d1ahq__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ahq__ d.109.1.2 (-) Cofilin (actin depolymerizing factor, ADF) {Amoeba (Acanthamoeba castellanii), actophorin}
giavsddcvqkfnelklghqhryvtfkmnasntevvvehvggpnatyedfksqlperdcr
yaifdyefqvdggqrnkitfilwapdsapikskmmytstkdsikkklvgiqvevqatdaa
eisedavserakk

SCOP Domain Coordinates for d1ahq__:

Click to download the PDB-style file with coordinates for d1ahq__.
(The format of our PDB-style files is described here.)

Timeline for d1ahq__: