Lineage for d3qa3d1 (3qa3 D:11-226)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744784Domain d3qa3d1: 3qa3 D:11-226 [408602]
    Other proteins in same PDB: d3qa3a2, d3qa3b2, d3qa3c2, d3qa3d2, d3qa3e_, d3qa3f2, d3qa3g_, d3qa3h2, d3qa3i_, d3qa3j2, d3qa3k2, d3qa3l_
    automated match to d6shgh_
    complexed with ca, edo, gol

Details for d3qa3d1

PDB Entry: 3qa3 (more details), 3 Å

PDB Description: Crystal Structure of A-domain in complex with antibody
PDB Compounds: (D:) antibody heavy chain

SCOPe Domain Sequences for d3qa3d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qa3d1 b.1.1.1 (D:11-226) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aelvkpgasvklsctpsgfnikdiymqwvkqrpeqglewigridpandktkydpkfqgka
titadtssntaylqlssltsedtavyycaseghygydgyamdywgqgttvtvssakttpp
svyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlss
svtvpssprpsetvtcnvahpasstkvdkkivprdc

SCOPe Domain Coordinates for d3qa3d1:

Click to download the PDB-style file with coordinates for d3qa3d1.
(The format of our PDB-style files is described here.)

Timeline for d3qa3d1:

  • d3qa3d1 is new in SCOPe 2.08-stable