Lineage for d1cofa_ (1cof A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2576227Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2576228Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2576435Family d.109.1.2: Cofilin-like [55762] (8 proteins)
  6. 2576448Protein Cofilin (actin depolymerizing factor, ADF) [55763] (4 species)
  7. 2576452Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55765] (3 PDB entries)
  8. 2576455Domain d1cofa_: 1cof A: [40860]

Details for d1cofa_

PDB Entry: 1cof (more details), 2.3 Å

PDB Description: yeast cofilin, orthorhombic crystal form
PDB Compounds: (A:) cofilin

SCOPe Domain Sequences for d1cofa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cofa_ d.109.1.2 (A:) Cofilin (actin depolymerizing factor, ADF) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vavadesltafndlklgkkykfilfglndakteivvketstdpsydafleklpendclya
iydfeyeingnegkrskivfftwspdtapvrskmvyasskdalrralngvstdvqgtdfs
evsydsvlervsrga

SCOPe Domain Coordinates for d1cofa_:

Click to download the PDB-style file with coordinates for d1cofa_.
(The format of our PDB-style files is described here.)

Timeline for d1cofa_: