Lineage for d3q6gh_ (3q6g H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2761531Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226133] (37 PDB entries)
  8. 2761534Domain d3q6gh_: 3q6g H: [408598]
    Other proteins in same PDB: d3q6gl2, d3q6gm2
    automated match to d6shgh_

Details for d3q6gh_

PDB Entry: 3q6g (more details), 1.9 Å

PDB Description: Crystal structure of Fab of rhesus mAb 2.5B specific for quaternary neutralizing epitope of HIV-1 gp120
PDB Compounds: (H:) Heavy chain of Fab of rhesus mAb 2.5B

SCOPe Domain Sequences for d3q6gh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q6gh_ b.1.1.0 (H:) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
qlqlqesgpglvkpsetlsltcavsggsisnnhwswirqppgkglewiglisgsggstdy
npslksrvtistdtsknqfslklssvtaadtavyycaridvvitsheddfgdyytgeyyg
ldswgqgvvvtvssastkgpsvfplapssrstsestaalgclvkdyfpepvtvswnsgsl
tsgvhtfpavlqssglyslssvvtvpssslgtqtyvcnvnhkpsntkvdkrvei

SCOPe Domain Coordinates for d3q6gh_:

Click to download the PDB-style file with coordinates for d3q6gh_.
(The format of our PDB-style files is described here.)

Timeline for d3q6gh_:

  • d3q6gh_ is new in SCOPe 2.08-stable