Lineage for d1cfyb_ (1cfy B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35145Fold d.109: Actin depolymerizing proteins [55752] (1 superfamily)
  4. 35146Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) (S)
  5. 35183Family d.109.1.2: Cofilin-like [55762] (2 proteins)
  6. 35184Protein Cofilin (actin depolymerizing factor, ADF) [55763] (3 species)
  7. 35188Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55765] (3 PDB entries)
  8. 35190Domain d1cfyb_: 1cfy B: [40859]

Details for d1cfyb_

PDB Entry: 1cfy (more details), 2.3 Å

PDB Description: yeast cofilin, monoclinic crystal form

SCOP Domain Sequences for d1cfyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cfyb_ d.109.1.2 (B:) Cofilin (actin depolymerizing factor, ADF) {Baker's yeast (Saccharomyces cerevisiae)}
vavadesltafndlklgkkykfilfglndakteivvketstdpsydafleklpendclya
iydfeyeingnegkrskivfftwspdtapvrskmvyasskdalrralngvstdvqgtdfs
evsydsvlervsr

SCOP Domain Coordinates for d1cfyb_:

Click to download the PDB-style file with coordinates for d1cfyb_.
(The format of our PDB-style files is described here.)

Timeline for d1cfyb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1cfya_