Lineage for d1f7sa_ (1f7s A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 83135Fold d.109: Actin depolymerizing proteins [55752] (1 superfamily)
  4. 83136Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) (S)
  5. 83174Family d.109.1.2: Cofilin-like [55762] (2 proteins)
  6. 83175Protein Cofilin (actin depolymerizing factor, ADF) [55763] (3 species)
  7. 83184Species Plant (Arabidopsis thaliana), ADF1 [TaxId:3702] [55764] (1 PDB entry)
  8. 83185Domain d1f7sa_: 1f7s A: [40857]

Details for d1f7sa_

PDB Entry: 1f7s (more details), 2 Å

PDB Description: crystal structure of adf1 from arabidopsis thaliana

SCOP Domain Sequences for d1f7sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f7sa_ d.109.1.2 (A:) Cofilin (actin depolymerizing factor, ADF) {Plant (Arabidopsis thaliana), ADF1}
asgmavhddcklrflelkakrthrfivykieekqkqvvvekvgqpiqtyeefaaclpade
cryaiydfdfvtaencqkskiffiawcpdiakvrskmiyasskdrfkreldgiqvelqat
dpte

SCOP Domain Coordinates for d1f7sa_:

Click to download the PDB-style file with coordinates for d1f7sa_.
(The format of our PDB-style files is described here.)

Timeline for d1f7sa_: