Lineage for d3nh7j_ (3nh7 J:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2743104Domain d3nh7j_: 3nh7 J: [408537]
    Other proteins in same PDB: d3nh7a_, d3nh7b_, d3nh7c_, d3nh7d_, d3nh7l1, d3nh7l2, d3nh7m1, d3nh7m2, d3nh7n1, d3nh7n2, d3nh7o1, d3nh7o2
    automated match to d6shgh_

Details for d3nh7j_

PDB Entry: 3nh7 (more details), 2.7 Å

PDB Description: Crystal structure of the neutralizing Fab fragment AbD1556 bound to the BMP type I receptor IA
PDB Compounds: (J:) Antibody fragment Fab AbD1556, heavy chain

SCOPe Domain Sequences for d3nh7j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nh7j_ b.1.1.1 (J:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqlvesggglvqpggslrlscaasgftfsnytlnwvrqapgkglewvsytsssgsltgy
adsvkgrftisrdnskntlylqmnslraedtavyycarerwhvrgyfdhwgqgtlvtvss
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

SCOPe Domain Coordinates for d3nh7j_:

Click to download the PDB-style file with coordinates for d3nh7j_.
(The format of our PDB-style files is described here.)

Timeline for d3nh7j_:

  • d3nh7j_ is new in SCOPe 2.08-stable