Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries) |
Domain d3nh7j_: 3nh7 J: [408537] Other proteins in same PDB: d3nh7a_, d3nh7b_, d3nh7c_, d3nh7d_, d3nh7l1, d3nh7l2, d3nh7m1, d3nh7m2, d3nh7n1, d3nh7n2, d3nh7o1, d3nh7o2 automated match to d6shgh_ |
PDB Entry: 3nh7 (more details), 2.7 Å
SCOPe Domain Sequences for d3nh7j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nh7j_ b.1.1.1 (J:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qvqlvesggglvqpggslrlscaasgftfsnytlnwvrqapgkglewvsytsssgsltgy adsvkgrftisrdnskntlylqmnslraedtavyycarerwhvrgyfdhwgqgtlvtvss astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
Timeline for d3nh7j_: