Lineage for d1eqys_ (1eqy S:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 83135Fold d.109: Actin depolymerizing proteins [55752] (1 superfamily)
  4. 83136Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) (S)
  5. 83137Family d.109.1.1: Gelsolin-like [55754] (3 proteins)
  6. 83138Protein Gelsolin [55759] (2 species)
  7. 83152Species Human (Homo sapiens) [TaxId:9606] [55761] (10 PDB entries)
  8. 83159Domain d1eqys_: 1eqy S: [40853]
    Other proteins in same PDB: d1eqya1, d1eqya2

Details for d1eqys_

PDB Entry: 1eqy (more details), 2.3 Å

PDB Description: complex between rabbit muscle alpha-actin: human gelsolin domain 1

SCOP Domain Sequences for d1eqys_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eqys_ d.109.1.1 (S:) Gelsolin {Human (Homo sapiens)}
mvvehpeflkagkepglqiwrvekfdlvpvptclygdfftgdayvilktvqlrngnlqyd
lhywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkgg
vasgf

SCOP Domain Coordinates for d1eqys_:

Click to download the PDB-style file with coordinates for d1eqys_.
(The format of our PDB-style files is described here.)

Timeline for d1eqys_: