| Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
| Fold d.109: Actin depolymerizing proteins [55752] (1 superfamily) |
Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) ![]() |
| Family d.109.1.1: Gelsolin-like [55754] (3 proteins) |
| Protein Gelsolin [55759] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [55761] (10 PDB entries) |
| Domain d1eqys_: 1eqy S: [40853] Other proteins in same PDB: d1eqya1, d1eqya2 |
PDB Entry: 1eqy (more details), 2.3 Å
SCOP Domain Sequences for d1eqys_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eqys_ d.109.1.1 (S:) Gelsolin {Human (Homo sapiens)}
mvvehpeflkagkepglqiwrvekfdlvpvptclygdfftgdayvilktvqlrngnlqyd
lhywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkgg
vasgf
Timeline for d1eqys_: