Lineage for d3ndze_ (3ndz E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767216Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) (S)
  5. 2767350Family b.2.2.0: automated matches [191610] (1 protein)
    not a true family
  6. 2767351Protein automated matches [191113] (13 species)
    not a true protein
  7. 2767380Species Clostridium cellulovorans [TaxId:1493] [419862] (2 PDB entries)
  8. 2767385Domain d3ndze_: 3ndz E: [408528]
    Other proteins in same PDB: d3ndza_, d3ndzb_, d3ndzc_, d3ndzd_
    automated match to d6qfsa_

Details for d3ndze_

PDB Entry: 3ndz (more details), 2.08 Å

PDB Description: the structure of the catalytic and carbohydrate binding domain of endoglucanase d from clostridium cellulovorans bound to cellotriose
PDB Compounds: (E:) Endoglucanase D

SCOPe Domain Sequences for d3ndze_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ndze_ b.2.2.0 (E:) automated matches {Clostridium cellulovorans [TaxId: 1493]}
savevtyaitnswgsgasvnvtiknngttpingwtlkwtmpinqtitnmwsasfvasgtt
lsvtnagyngtiaanggtqsfgfninysgvlskptgftvngtectvk

SCOPe Domain Coordinates for d3ndze_:

Click to download the PDB-style file with coordinates for d3ndze_.
(The format of our PDB-style files is described here.)

Timeline for d3ndze_:

  • d3ndze_ is new in SCOPe 2.08-stable