Lineage for d3na9h1 (3na9 H:1-210)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (30 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1747 PDB entries)
  8. 2754505Domain d3na9h1: 3na9 H:1-210 [408515]
    Other proteins in same PDB: d3na9h2, d3na9l2
    automated match to d6shgh_
    complexed with act, gol, zn

Details for d3na9h1

PDB Entry: 3na9 (more details), 1.7 Å

PDB Description: crystal structure of fab15
PDB Compounds: (H:) Fab15 heavy chain

SCOPe Domain Sequences for d3na9h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3na9h1 b.1.1.0 (H:1-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvqsgaevkkpgeslkisckgsgysftnywvgwvrqmpgkglewmgfidpsdsytny
apsfqgqvtisadksistaylqwsslkasdtamyycarelyqgymdtfdswgqgtlvtvs
sastkgpsvfplapcsrstsestaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
sglyslssvvtvpssslgtktytcnvdhkpsntkvdkr

SCOPe Domain Coordinates for d3na9h1:

Click to download the PDB-style file with coordinates for d3na9h1.
(The format of our PDB-style files is described here.)

Timeline for d3na9h1:

  • d3na9h1 is new in SCOPe 2.08-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d3na9h2