Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries) |
Domain d3mugh_: 3mug H: [408507] Other proteins in same PDB: d3muga1, d3muga2, d3mugc1, d3mugc2, d3muge1, d3muge2, d3mugg1, d3mugg2, d3mugi1, d3mugi2, d3mugk1, d3mugk2 automated match to d6shgh_ complexed with nag |
PDB Entry: 3mug (more details), 2.49 Å
SCOPe Domain Sequences for d3mugh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mugh_ b.1.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]} eeqlvesgggvvqpggslrlsclasgftfhkygmhwvrqapgkglewvalisddgmrkyh sdsmwgrvtisrdnskntlylqfsslkvedtamffcareaggpiwhddvkyydfndgyyn yhymdvwgkgttvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswns galtsgvhtfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepks
Timeline for d3mugh_: