SCOPe 2.08: Domain d3mlyi1: 3mly I:6-216

Lineage for d3mlyi1 (3mly I:6-216)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d3mlyi1: 3mly I:6-216 [408500]
   Other proteins in same PDB: d3mlyh2, d3mlyi2, d3mlyl2, d3mlym2
   automated match to d6shgh_

Details for d3mlyi1

PDB Entry: 3mly, 1.7 Å

PDB Description: crystal structure of anti-hiv-1 v3 fab 3074 in complex with a ur29 v3 peptide

PDB Compounds: (I:) Human monoclonal anti-HIV-1 gp120 V3 antibody 3074 Fab heavy chain

SCOPe Domain Sequences for d3mlyi1:

Sequence; same for both SEQRES and ATOM records:

>d3mlyi1 b.1.1.0 (I:6-216) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esgpglvkpsetlsltctvsggsisgfhwswirqppgkgleyigyiyysgstsynpslks
rvsmsvdtsrnqfslelssvtaadtavyycardfgeyhydgrgfqcegfdlwgqgtlvtv
ssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlq
ssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

Timeline for d3mlyi1:

• d3mlyi1 is new in SCOPe 2.08-stable