Lineage for d1dejs_ (1dej S:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 83135Fold d.109: Actin depolymerizing proteins [55752] (1 superfamily)
  4. 83136Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) (S)
  5. 83137Family d.109.1.1: Gelsolin-like [55754] (3 proteins)
  6. 83138Protein Gelsolin [55759] (2 species)
  7. 83152Species Human (Homo sapiens) [TaxId:9606] [55761] (10 PDB entries)
  8. 83164Domain d1dejs_: 1dej S: [40850]
    Other proteins in same PDB: d1deja1, d1deja2

Details for d1dejs_

PDB Entry: 1dej (more details), 2.4 Å

PDB Description: crystal structure of a dictyostelium/tetrahymena chimera actin (mutant 646: q228k/t229a/a230y/a231k/s232e/e360h) in complex with human gelsolin segment 1

SCOP Domain Sequences for d1dejs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dejs_ d.109.1.1 (S:) Gelsolin {Human (Homo sapiens)}
mgsvvehpeflkagkepglqiwrvekfdlvpvptclygdfftgdayvilktvqlrngnlq
ydlhywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykk
ggvasgf

SCOP Domain Coordinates for d1dejs_:

Click to download the PDB-style file with coordinates for d1dejs_.
(The format of our PDB-style files is described here.)

Timeline for d1dejs_: