Lineage for d3mlyh1 (3mly H:6-216)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2754942Domain d3mlyh1: 3mly H:6-216 [408498]
    Other proteins in same PDB: d3mlyh2, d3mlyi2, d3mlyl2, d3mlym2
    automated match to d6shgh_

Details for d3mlyh1

PDB Entry: 3mly (more details), 1.7 Å

PDB Description: crystal structure of anti-hiv-1 v3 fab 3074 in complex with a ur29 v3 peptide
PDB Compounds: (H:) Human monoclonal anti-HIV-1 gp120 V3 antibody 3074 Fab heavy chain

SCOPe Domain Sequences for d3mlyh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mlyh1 b.1.1.0 (H:6-216) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esgpglvkpsetlsltctvsggsisgfhwswirqppgkgleyigyiyysgstsynpslks
rvsmsvdtsrnqfslelssvtaadtavyycardfgeyhydgrgfqcegfdlwgqgtlvtv
ssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlq
ssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

SCOPe Domain Coordinates for d3mlyh1:

Click to download the PDB-style file with coordinates for d3mlyh1.
(The format of our PDB-style files is described here.)

Timeline for d3mlyh1:

  • d3mlyh1 is new in SCOPe 2.08-stable