Lineage for d3mlvn_ (3mlv N:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2758117Domain d3mlvn_: 3mlv N: [408491]
    Other proteins in same PDB: d3mlvl2, d3mlvm2
    automated match to d6shgh_

Details for d3mlvn_

PDB Entry: 3mlv (more details), 2.48 Å

PDB Description: crystal structure of anti-hiv-1 v3 fab 2557 in complex with an nof v3 peptide
PDB Compounds: (N:) Human monoclonal anti-HIV-1 gp120 V3 antibody 2557 Fab heavy chain

SCOPe Domain Sequences for d3mlvn_:

Sequence, based on SEQRES records: (download)

>d3mlvn_ b.1.1.0 (N:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggevkqpgqslkisckssgynfldswigwvrqipgkglewigiiypddsdahy
spsfegqvtmsvdksistaylqwttlqasdtgkyfctrlylfegaqssnafdlwgqgtmi
lvssgttkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpav
lqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks

Sequence, based on observed residues (ATOM records): (download)

>d3mlvn_ b.1.1.0 (N:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggevkqpgqslkisckssgynfldswigwvrqipgkglewigiiypddsdahy
spsfegqvtmsvdksistaylqwttlqasdtgkyfctrlylfegaqssnafdlwgqgtmi
lvssgttkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks

SCOPe Domain Coordinates for d3mlvn_:

Click to download the PDB-style file with coordinates for d3mlvn_.
(The format of our PDB-style files is described here.)

Timeline for d3mlvn_:

  • d3mlvn_ is new in SCOPe 2.08-stable