Lineage for d3l7fb_ (3l7f B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2758562Domain d3l7fb_: 3l7f B: [408449]
    Other proteins in same PDB: d3l7fa2, d3l7fd2, d3l7fl2
    automated match to d6shgh_
    complexed with ca, so4

Details for d3l7fb_

PDB Entry: 3l7f (more details), 2.6 Å

PDB Description: structure of il-13 antibody h2l6, a humanized variant of c836
PDB Compounds: (B:) h2l6 heavy chain

SCOPe Domain Sequences for d3l7fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l7fb_ b.1.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evtlkesgpvlvkptetltltctvsgfslstygmgvgwirqppgkalewlahiwwddvkr
ynpalksrltiskdtsksqvvltmtnmdpvdtatyycarmgsdydvwfdywgqgtlvtvs
sastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

SCOPe Domain Coordinates for d3l7fb_:

Click to download the PDB-style file with coordinates for d3l7fb_.
(The format of our PDB-style files is described here.)

Timeline for d3l7fb_:

  • d3l7fb_ is new in SCOPe 2.08-stable