Lineage for d1d0nb5 (1d0n B:533-628)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 261128Fold d.109: Gelsolin-like [55752] (2 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 261129Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) (S)
  5. 261130Family d.109.1.1: Gelsolin-like [55754] (4 proteins)
  6. 261131Protein Gelsolin [55759] (2 species)
    consists of six similar domains
  7. 261132Species Horse (Equus caballus) [TaxId:9796] [55760] (1 PDB entry)
  8. 261143Domain d1d0nb5: 1d0n B:533-628 [40844]

Details for d1d0nb5

PDB Entry: 1d0n (more details), 2.5 Å

PDB Description: the crystal structure of calcium-free equine plasma gelsolin.

SCOP Domain Sequences for d1d0nb5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d0nb5 d.109.1.1 (B:533-628) Gelsolin {Horse (Equus caballus)}
pastrlfqvrasssgatraveiipkagalnsndafvlktpsaaylwvgagaseaektgaq
ellrvlraqpvqvaegsepdsfwealggkatyrtsp

SCOP Domain Coordinates for d1d0nb5:

Click to download the PDB-style file with coordinates for d1d0nb5.
(The format of our PDB-style files is described here.)

Timeline for d1d0nb5: