Lineage for d1d0nb4 (1d0n B:384-532)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 136694Fold d.109: Actin depolymerizing proteins [55752] (1 superfamily)
  4. 136695Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) (S)
  5. 136696Family d.109.1.1: Gelsolin-like [55754] (3 proteins)
  6. 136697Protein Gelsolin [55759] (2 species)
  7. 136698Species Horse (Equus caballus) [TaxId:9796] [55760] (1 PDB entry)
  8. 136708Domain d1d0nb4: 1d0n B:384-532 [40843]

Details for d1d0nb4

PDB Entry: 1d0n (more details), 2.5 Å

PDB Description: the crystal structure of calcium-free equine plasma gelsolin.

SCOP Domain Sequences for d1d0nb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d0nb4 d.109.1.1 (B:384-532) Gelsolin {Horse (Equus caballus)}
sshiahvervpfdaatlhtstamaaqhgmdddgtgqkqiwrvegsnkvpvdpatygqfyg
gdsyiilynyrhgsrqgqiiynwqgaqstqdevaasailtaqldeelggtpvqsrvvqgk
epahlmslfggkpmivykggtsreggqta

SCOP Domain Coordinates for d1d0nb4:

Click to download the PDB-style file with coordinates for d1d0nb4.
(The format of our PDB-style files is described here.)

Timeline for d1d0nb4: