Lineage for d1d0nb3 (1d0n B:263-383)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2969655Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2969656Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2969657Family d.109.1.1: Gelsolin-like [55754] (5 proteins)
  6. 2969658Protein Gelsolin [55759] (2 species)
    consists of six similar domains
  7. 2969659Species Horse (Equus caballus) [TaxId:9796] [55760] (2 PDB entries)
    Uniprot Q28372 1-346
  8. 2969668Domain d1d0nb3: 1d0n B:263-383 [40842]

Details for d1d0nb3

PDB Entry: 1d0n (more details), 2.5 Å

PDB Description: the crystal structure of calcium-free equine plasma gelsolin.
PDB Compounds: (B:) horse plasma gelsolin

SCOPe Domain Sequences for d1d0nb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d0nb3 d.109.1.1 (B:263-383) Gelsolin {Horse (Equus caballus) [TaxId: 9796]}
edaanrklaklykvsngagpmvvslvadenpfaqgalrsedcfildhgkdgkifvwkgkq
anmeerkaalktasdfiskmdypkqtqvsvlpeggetplfrqffknwrdpdqteglglay
l

SCOPe Domain Coordinates for d1d0nb3:

Click to download the PDB-style file with coordinates for d1d0nb3.
(The format of our PDB-style files is described here.)

Timeline for d1d0nb3: