Lineage for d3ijsd_ (3ijs D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (23 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (610 PDB entries)
  8. 2744736Domain d3ijsd_: 3ijs D: [408418]
    Other proteins in same PDB: d3ijsa1, d3ijsa2, d3ijsc1, d3ijsc2
    automated match to d6shgh_
    complexed with mg

Details for d3ijsd_

PDB Entry: 3ijs (more details), 2.55 Å

PDB Description: structure of s67-27 in complex with tsbp
PDB Compounds: (D:) Immunoglobulin heavy chain (IGG3)

SCOPe Domain Sequences for d3ijsd_:

Sequence, based on SEQRES records: (download)

>d3ijsd_ b.1.1.1 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evmlvesggglvqpgnslrlscatsgftftdyymswvrqppgkalewlgfirnkakgytt
eysasvkgrftisrdnsqsilylqmntlraedsatyycardispsygvyyegfaywgqgt
lvtvsaatttapsvyplvpgcsdtsgssvtlgclvkgyfpepvtvkwnygalssgvrtvs
svlqsgfyslsslvtvpsstwpsqtvicnvahpasktelikriepr

Sequence, based on observed residues (ATOM records): (download)

>d3ijsd_ b.1.1.1 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evmlvesggglvqpgnslrlscatsgftftdyymswvrqppgkalewlgfirnkakgytt
eysasvkgrftisrdnsqsilylqmntlraedsatyycardispsygvyyegfaywgqgt
lvtvsaatttapsvyplvpggssvtlgclvkgyfpepvtvkwnygalssgvrtvssvlqs
gfyslsslvtvpsstwpsqtvicnvahpasktelikriepr

SCOPe Domain Coordinates for d3ijsd_:

Click to download the PDB-style file with coordinates for d3ijsd_.
(The format of our PDB-style files is described here.)

Timeline for d3ijsd_:

  • d3ijsd_ is new in SCOPe 2.08-stable