Lineage for d1d0nb2 (1d0n B:153-262)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1427557Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1427558Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 1427559Family d.109.1.1: Gelsolin-like [55754] (5 proteins)
  6. 1427560Protein Gelsolin [55759] (2 species)
    consists of six similar domains
  7. 1427561Species Horse (Equus caballus) [TaxId:9796] [55760] (2 PDB entries)
    Uniprot Q28372 1-346
  8. 1427569Domain d1d0nb2: 1d0n B:153-262 [40841]

Details for d1d0nb2

PDB Entry: 1d0n (more details), 2.5 Å

PDB Description: the crystal structure of calcium-free equine plasma gelsolin.
PDB Compounds: (B:) horse plasma gelsolin

SCOPe Domain Sequences for d1d0nb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d0nb2 d.109.1.1 (B:153-262) Gelsolin {Horse (Equus caballus) [TaxId: 9796]}
vpnevvvqrllqvkgrrvvratevpvswesfnngdcfildlgnniyqwcgsksnrferlk
atqvskgirdnersgraqvsvfeegaepeamlqvlgpkptlpeatedtvk

SCOPe Domain Coordinates for d1d0nb2:

Click to download the PDB-style file with coordinates for d1d0nb2.
(The format of our PDB-style files is described here.)

Timeline for d1d0nb2: