Lineage for d1d0nb2 (1d0n B:153-262)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 195656Fold d.109: Actin depolymerizing proteins [55752] (1 superfamily)
  4. 195657Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) (S)
  5. 195658Family d.109.1.1: Gelsolin-like [55754] (4 proteins)
  6. 195659Protein Gelsolin [55759] (2 species)
  7. 195660Species Horse (Equus caballus) [TaxId:9796] [55760] (1 PDB entry)
  8. 195668Domain d1d0nb2: 1d0n B:153-262 [40841]

Details for d1d0nb2

PDB Entry: 1d0n (more details), 2.5 Å

PDB Description: the crystal structure of calcium-free equine plasma gelsolin.

SCOP Domain Sequences for d1d0nb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d0nb2 d.109.1.1 (B:153-262) Gelsolin {Horse (Equus caballus)}
vpnevvvqrllqvkgrrvvratevpvswesfnngdcfildlgnniyqwcgsksnrferlk
atqvskgirdnersgraqvsvfeegaepeamlqvlgpkptlpeatedtvk

SCOP Domain Coordinates for d1d0nb2:

Click to download the PDB-style file with coordinates for d1d0nb2.
(The format of our PDB-style files is described here.)

Timeline for d1d0nb2: